Gene Bio Systems
Recombinant Azorhizobium caulinodans UPF0060 membrane protein AZC_0909 (AZC_0909)
Recombinant Azorhizobium caulinodans UPF0060 membrane protein AZC_0909 (AZC_0909)
SKU:CSB-CF426880DPR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571)
Uniprot NO.:A8HU57
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLPLFALAALAEIAGCFAFWHVVRAGGSPLWLAPGVLSLVAFAALLTQVEADAAGRAFA AYGGIYILASLGWMWAAEGVRPDRFDALGAAICLAGACVILFAPRG
Protein Names:Recommended name: UPF0060 membrane protein AZC_0909
Gene Names:Ordered Locus Names:AZC_0909
Expression Region:1-106
Sequence Info:full length protein
