Skip to product information
1 of 1

Gene Bio Systems

Recombinant Avena sativa V-type proton ATPase 16 kDa proteolipid subunit(VATP-P1)

Recombinant Avena sativa V-type proton ATPase 16 kDa proteolipid subunit(VATP-P1)

SKU:CSB-CF002389DPO

Regular price £1,239.00 GBP
Regular price Sale price £1,239.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Avena sativa (Oat)

Uniprot NO.:P23957

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV MAGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD

Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit

Gene Names:Name:VATP-P1

Expression Region:1-165

Sequence Info:full length protein

View full details