Skip to product information
1 of 1

Gene Bio Systems

Recombinant Autographa californica nuclear polyhedrosis virus Viral cathepsin(VCATH)

Recombinant Autographa californica nuclear polyhedrosis virus Viral cathepsin(VCATH)

SKU:CSB-EP340730ARA

Regular price £893.00 GBP
Regular price Sale price £893.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P25783

Gene Names: VCATH

Organism: Autographa californica nuclear polyhedrosis virus (AcMNPV)

AA Sequence: PLEFDWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINLSEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVGYGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY

Expression Region: 113-323aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 39.9 kDa

Alternative Name(s): Cysteine proteinase Short name: CP

Relevance: Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system (By similarity).

Reference: "The baculovirus Autographa californica nuclear polyhedrosis virus genome includes a papain-like sequence."Rawlings N.D., Pearl L.H., Buttle D.J.Biol. Chem. Hoppe-Seyler 373:1211-1215(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details