Gene Bio Systems
Recombinant ATP synthase protein I(atpI)
Recombinant ATP synthase protein I(atpI)
SKU:CSB-CF359598SZB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shigella flexneri
Uniprot NO.:P0ABC2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SVSLVSRNVARKLLLVQLLVVIASGLLFSLKDPFWGVSAISGGLAVFLPNVLFMIFAWRH QAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALAVLKAVFLPLIVTWVLVLVVQILAPAV INNKG
Protein Names:Recommended name: ATP synthase protein I
Gene Names:Name:atpI Ordered Locus Names:SF3819, S3949
Expression Region:2-126
Sequence Info:full length protein
