Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ascaris suum ATP synthase subunit a(ATP6)

Recombinant Ascaris suum ATP synthase subunit a(ATP6)

SKU:CSB-CF015070DOS

Regular price £1,265.00 GBP
Regular price Sale price £1,265.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ascaris suum (Pig roundworm) (Ascaris lumbricoides)

Uniprot NO.:P24876

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTNVYFLDIFMFVYVLQFLFYFKESMLGVLVNKFLGLLVVVFSYTDSLPLSSVISVFTFL VLLTCCFGGYFMYSFCPCGMIEFTFVYAMVAWLSTLLTFITSEKFSIYISKAGDSFLKTF SMLLVELVSEVSRPLALTVRLTVNVLVGHVISMMLYQLLELYLGIFYVWIVVLAIVMECF VFFIQSYIFSRLIYLYLNE

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6

Gene Names:Name:ATP6

Expression Region:1-199

Sequence Info:full length protein

View full details