Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arthrobacter globiformis Uricase(uox),partial

Recombinant Arthrobacter globiformis Uricase(uox),partial

SKU:CSB-YP025648DOH

Regular price £958.00 GBP
Regular price Sale price £958.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: D0VWQ1

Gene Names: uox

Organism: Arthrobacter globiformis

AA Sequence: TKVVLGQNQYGKAEVRLVKVTRNTARHEIQDLNVTSQLRGDFEAAHTAGDNAHVVATDTQKNTVYAFARDGFATTEEFLLRLGKHFTEGFDWVTGGRWAAQQFFWDRINDHDHAFSRNKSEVRTAVLEISGSEQAIVAGIEGLTVLKSTGSEFHGFPRDKYTTLQETTDRILATDVSARWRYNTVEVDFDAVYASVRGLLLKAFAETHSLALQQTMYEMGRAVIETHPEIDEIKMSLPNKHHFLVDLQPFGQDNPNEVFYAADRPYGLIEATIQREGSRADHPIWSN

Expression Region: 11-297aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 34.4 kDa

Alternative Name(s): Urate oxidase Short name: AgUOX

Relevance: Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S)-allantoin.

Reference: "Structures of Arthrobacter globiformis urate oxidase-ligand complexes."Juan E.C., Hoque M.M., Shimizu S., Hossain M.T., Yamamoto T., Imamura S., Suzuki K., Tsunoda M., Amano H., Sekiguchi T., Takenaka A.Acta Crystallogr. D 64:815-822(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details