Gene Bio Systems
Recombinant Arabidopsis thaliana Uncharacterized protein At4g01150, chloroplastic (At4g01150)
Recombinant Arabidopsis thaliana Uncharacterized protein At4g01150, chloroplastic (At4g01150)
SKU:CSB-CF522360DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:O04616
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ASSEETSSIDTNELITDLKEKWDGLENKSTVLIYGGGAIVAVWLSSIVVGAINSVPLLPK VMELVGLGYTGWFVYRYLLFKSSRKELAEDIESLKKKIAGSE
Protein Names:Recommended name: Uncharacterized protein At4g01150, chloroplastic
Gene Names:Ordered Locus Names:At4g01150 ORF Names:A_IG002N01.18, F2N1.18
Expression Region:63-164
Sequence Info:full length protein
