Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00170-AtMg00620 (AtMg00170)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00170-AtMg00620 (AtMg00170)

SKU:CSB-CF310133DOA

Regular price £1,219.00 GBP
Regular price Sale price £1,219.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P94024

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIQRTRNQSIMLSLPSNQSANHAILTFQPIGQSRYLLTFQPTPSIPLLQQYIISVPYLDA YSSICFPVMARIRSAKYCFFFFLVLFLNGIIATRGKAMLPTLPQKGAAFFPPKMPVPPSG PSKQHNSAPRSDFVQFFYM

Protein Names:Recommended name: Uncharacterized mitochondrial protein AtMg00170/AtMg00620 Alternative name(s): ORF139b/ORF139a

Gene Names:Ordered Locus Names:AtMg00170 ANDOrdered Locus Names: AtMg00620

Expression Region:1-139

Sequence Info:full length protein

View full details