Recombinant Arabidopsis thaliana  Uncharacterized mitochondrial protein AtMg00150 (AtMg00150)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00150 (AtMg00150)

CSB-CF310113DOA
Regular price
£866.00 GBP
Sale price
£866.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P93284

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSRSSIGPELEVNSKPLKGPIICPIRTYYSKVPLELLFPTTDRRFYFLKSYVFCSANSVP LYLLLLTSALHFNSYILLFDFQLKSKLLAYKRRARCVAGLLKSMERYPESTVTAMI

Protein Names:Recommended name: Uncharacterized mitochondrial protein AtMg00150 Alternative name(s): ORF116

Gene Names:Ordered Locus Names:AtMg00150

Expression Region:1-116

Sequence Info:full length protein

Your list is ready to share