Recombinant Arabidopsis thaliana Translocon-associated protein subunit alpha (At2g21160)

SKU: CSB-CF022717DOA

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P45434

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QSDAEDHSSLVDDVVGENTDDAVEEDDHDLDMNLSSFPGVETVCVFPKNSAKLVPAGEETELLVGLKNEGKTRVGVMGIRASVHLPYDHKLLVQNLTMLRLNNASIPTSLQATFPYIFAVSQYLQPGAFDLVGYIIYDVEGKPYQSVFYNGTIEVVESGGLLSGESVFLLTLGIGLLLLLGLWAYSQVQRLTKKTKKVSKVEVGTRSTEASLDEWLEGTTLAKTSSGKTKNKKN

Protein Names:Recommended name: Translocon-associated protein subunit alpha Short name= TRAP-alpha Alternative name(s): Signal sequence receptor subunit alpha Short name= SSR-alpha

Gene Names:Ordered Locus Names:At2g21160 ORF Names:F26H11.8

Expression Region:25-258

Sequence Info:full length protein