Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL78(ATL78)

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL78(ATL78)

SKU:CSB-CF754110DOA

Regular price £1,285.00 GBP
Regular price Sale price £1,285.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q6NQG7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCTTISISISTIKPTEIFQEILGSSYSRKLLFHTHDQSPTPAPSPYVGDNNFDANVVMVL SVLLCALVCSLGLNSIIRCALRCSNLVPSEAGGDNYPVRLTNTGVKRKALKSFQTVSYST ELNLPGLDTECAICLSEFVAEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLIQTC EKIADCSQTSSLNSTQPPQDSIILQIAPLEPERWIRWFR

Protein Names:Recommended name: RING-H2 finger protein ATL78

Gene Names:Name:ATL78 Ordered Locus Names:At1g49230 ORF Names:F27J15.2

Expression Region:1-219

Sequence Info:full length protein

View full details