Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Rhodanese-like domain-containing protein 4A, chloroplastic(STR4A)

Recombinant Arabidopsis thaliana Rhodanese-like domain-containing protein 4A, chloroplastic(STR4A)

SKU:CSB-CF704104DOA

Regular price £1,275.00 GBP
Regular price Sale price £1,275.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q56XR7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASESFDSISSDPSSGKIDLESILVTIDNFFNKYPFFVAGCTFTYLVVYPAVMFYLRKYKP ISAMNAFRKLKNESDSQLLDIRDVKTLALLASPNLKFLGKSSVQVPFSENDEEGFLTKVK GSFSDAENTVVCVLDNFDGNSSKVAELLIKNGFKEAYYIRGGARGKNGWLAIQEELLPPP VHMYTAKNVKSSNNNEASVVGTEN

Protein Names:Recommended name: Rhodanese-like domain-containing protein 4A, chloroplastic Alternative name(s): Sulfurtransferase 4A Short name= AtStr4a

Gene Names:Name:STR4A Ordered Locus Names:At3g25480 ORF Names:MWL2.9

Expression Region:61-264

Sequence Info:full length protein

View full details