Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL61(ATL61)

Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL61(ATL61)

SKU:CSB-CF878596DOA

Regular price £1,275.00 GBP
Regular price Sale price £1,275.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LUL6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKESDAVILIHLGINIVFAFFFFGISAVVVSCIIKCYNTHDDDHDHDNNNDGHVSITIKE RVGIKPYVLRSIPIVDFNTKDFKYVLECVVCLSELADGDKARVLPSCDHWFHVECIDSWL QSNSTCPICRKRVCLKQSRTRPELGGRDKSFNQNHDQTSEHHEFSTDPPTNTDTAIIEDG GCGEANEGQPELTAVVIDIPAKEI

Protein Names:Recommended name: Putative RING-H2 finger protein ATL61

Gene Names:Name:ATL61 Ordered Locus Names:At3g14320 ORF Names:MLN21.11

Expression Region:1-204

Sequence Info:full length protein

View full details