Gene Bio Systems
Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL19(ATL19)
Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL19(ATL19)
SKU:CSB-CF866398DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9C919
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSEEDDAISLISVLGLAVFIGLCILLVVLIATSALILVIYVIIDCILRPFLGTCLDLDL EIGVQRGQQRARIVTYHTIISTGLRLPDFEREGKKRGLKQSVIETLLPKLLVGQGNHEED EEKSLESRECAICLSGYVVNEECRVFPVCRHIYHALCIDAWLKNHLTCPTCRKDLPES
Protein Names:Recommended name: Putative RING-H2 finger protein ATL19
Gene Names:Name:ATL19 Ordered Locus Names:At1g53010 ORF Names:F14G24.29, F8L10.17
Expression Region:1-178
Sequence Info:full length protein
