Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein transport protein Sec61 subunit beta (At2g45070)

Recombinant Arabidopsis thaliana Protein transport protein Sec61 subunit beta (At2g45070)

SKU:CSB-CF020958DOA

Regular price £1,188.00 GBP
Regular price Sale price £1,188.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P38389

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVGSGAPQRGSAAATASMRRRKPTSGAGGGGASGGAAGSMLQFYTDDAPGLKISPNVVLIMSIGFIAFVAVLHVMGKLYFVK

Protein Names:Recommended name: Protein transport protein Sec61 subunit beta

Gene Names:Ordered Locus Names:At2g45070 ORF Names:T14P1.12

Expression Region:1-82

Sequence Info:full length protein

View full details