Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein RER1B(RER1B)

Recombinant Arabidopsis thaliana Protein RER1B(RER1B)

SKU:CSB-CF527392DOA

Regular price £1,264.00 GBP
Regular price Sale price £1,264.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O48671

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEGSGGDSGSMATPVQKKVHEAWRVYQYYLDKTTPHSTNRWIGTLVFFLIYCLRVYSIHG FYIISYGLGIYLLNLLIGFLSPLVDPELEVSDGATLPTRGSDEFKPFIRRLPEFKFWYSM TKAFCIAFLMTFFSVFDVPVFWPILLCYWVVLFVLTMRRQIAHMIKHKYIPFSIGKQKYS GRKSSANSGGGSRAD

Protein Names:Recommended name: Protein RER1B Short name= AtRER1B

Gene Names:Name:RER1B Ordered Locus Names:At2g21600 ORF Names:F2G1.13

Expression Region:1-195

Sequence Info:full length protein

View full details