Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana PRA1 family protein F3(PRA1F3)

Recombinant Arabidopsis thaliana PRA1 family protein F3(PRA1F3)

SKU:CSB-CF881734DOA

Regular price £1,261.00 GBP
Regular price Sale price £1,261.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LIC6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTNYGAIPTSSHASPLVDVESLSRAKHRIKAGLATRRAWRVMFDFHSMGLPHGVSDAFTR IKTNLAYFRMNYAIVVLIVIFFSLIWHPTSLIVFTVLVVVWIFLYFLRDEPIKLFRFQID DRTVLIVLSVLTVVLLLLTNATFNIVGALVTGAVLVLIHSVVRKTEDLFLDEEAATTETS GLTSYPST

Protein Names:Recommended name: PRA1 family protein F3 Short name= AtPRA1.F3

Gene Names:Name:PRA1F3 Ordered Locus Names:At3g13720 ORF Names:MMM17.14

Expression Region:1-188

Sequence Info:full length protein

View full details