Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana PRA1 family protein D(PRA1D)

Recombinant Arabidopsis thaliana PRA1 family protein D(PRA1D)

SKU:CSB-CF309770DOA

Regular price £1,256.00 GBP
Regular price Sale price £1,256.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P93829

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANQVITGIKETAQSITGAARPWGDFLDLSAFSFPSSIADATTRVTQNLTHFRINYSIIL SILLGLTLITRPIAILAFIAVGLAWFFLYFAREEPLTIFGFTIDDGIVAVLLIGLSIGSL VTTGVWLRALTTVGFGVLVLILHAALRGTDDLVSDDLESPYGPMLSTSGGGNDGARGDYS GI

Protein Names:Recommended name: PRA1 family protein D Short name= AtPRA1.D Alternative name(s): CAMV MOVEMENT PROTEIN-INTERACTING PROTEIN 7 Prenylated Rab acceptor 5

Gene Names:Name:PRA1D Synonyms:MPI7, MPIP7, PRA5 Ordered Locus Names:At1g04260 ORF Names:F19P19.30

Expression Region:1-182

Sequence Info:full length protein

View full details