Recombinant Arabidopsis thaliana Outer envelope pore protein 16-2, chloroplastic(OEP162)

SKU: CSB-CF608678DOA

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q0WMZ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKSGGRIVMDEIRSFEKAHLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDGA GFDSNNVGPPSEITGNKKHRFPNLRGESSKSLDALVKNTGKESLQWGLAAGLYSGITYGM TEVRGGAHDWRNSAVAGALTGAAMAMTTSERTSHEQVVQSALTGAAISTAANLLSSVF

Protein Names:Recommended name: Outer envelope pore protein 16-2, chloroplastic Alternative name(s): Chloroplastic outer envelope pore protein of 16 kDa 2 Short name= AtOEP16-2 Short name= OEP16-2 Outer plastid envelope protein 16-S Short

Gene Names:Name:OEP162 Ordered Locus Names:At4g16160 ORF Names:dl4120w, FCAALL.207

Expression Region:1-178

Sequence Info:full length protein