Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Oleosin 20.3 kDa(OL2)

Recombinant Arabidopsis thaliana Oleosin 20.3 kDa(OL2)

SKU:CSB-CF671459DOA

Regular price £1,259.00 GBP
Regular price Sale price £1,259.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q42431

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ANVDRDRRVHVDRTDKRVHQPNYEDDVGFGGYGGYGAGSDYKSRGPSTNQILALIAGVPI GGTLLTLAGLTLAGSVIGLLVSIPLFLLFSPVIVPAALTIGLAVTGILASGLFGLTGLSS VSWVLNYLRGTSDTVPEQLDYAKRRMADAVGYAGMKGKEMGQYVQDKAHEARETEFMTET HEPGKARRGS

Protein Names:Recommended name: Oleosin 20.3 kDa Alternative name(s): Oleosin type 4

Gene Names:Name:OL2 Ordered Locus Names:At3g27660 ORF Names:MGF10.7

Expression Region:2-191

Sequence Info:full length protein

View full details