Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana NEP1-interacting protein 1(NIP1)

Recombinant Arabidopsis thaliana NEP1-interacting protein 1(NIP1)

SKU:CSB-CF810144DOA

Regular price £1,327.00 GBP
Regular price Sale price £1,327.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8GT75

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASSRFQSGFCPISSCPSLENFIERIKDACRFTLSAVLGTILSAVLTFFFALVGTLLGAL TGALIGQETESGFIRGAAVGAISGAVFSIEVFESSLVLWKSNESRFGCLLYLIDVIVSLI SGRLVRERIGPAMLSAVQSQMGAVDSTFEELSSIFDTGGSKGLTGDLVDKIPKIKITGKN NLDASGNKDSCSVCLQDFQLGETVRSLPHCHHMFHLPCIDNWLFRHGSCPMCRRDL

Protein Names:Recommended name: NEP1-interacting protein 1 Alternative name(s): RING-H2 finger protein ATL26

Gene Names:Name:NIP1 Synonyms:ATL26 Ordered Locus Names:At4g35840 ORF Names:F4B14.110

Expression Region:1-236

Sequence Info:full length protein

View full details