Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Mitochondrial carnitine-acylcarnitine carrier-like protein(BOU)

Recombinant Arabidopsis thaliana Mitochondrial carnitine-acylcarnitine carrier-like protein(BOU)

SKU:CSB-CF856673DOA

Regular price £1,359.00 GBP
Regular price Sale price £1,359.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q93XM7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADAWKDLASGTVGGAAQLVVGHPFDTIKVKLQSQPTPAPGQLPRYTGAIDAVKQTVASE GTKGLYKGMGAPLATVAAFNAVLFTVRGQMEGLLRSEAGVPLTISQQFVAGAGAGFAVSF LACPTELIKCRLQAQGALAGASTTSSVVAAVKYGGPMDVARHVLRSEGGARGLFKGLFPT FAREVPGNATMFAAYEAFKRFLAGGSDTSSLGQGSLIMAGGVAGASFWGIVYPTDVVKSV LQVDDYKNPRYTGSMDAFRKILKSEGVKGLYKGFGPAMARSVPANAACFLAYEMTRSSLG

Protein Names:Recommended name: Mitochondrial carnitine/acylcarnitine carrier-like protein Alternative name(s): Carnitine/acylcarnitine translocase-like protein Short name= CAC-like protein Protein A BOUT DE SOUFFLE

Gene Names:Name:BOU Ordered Locus Names:At5g46800 ORF Names:MZA15.23

Expression Region:1-300

Sequence Info:full length protein

View full details