Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Mannose-P-dolichol utilization defect 1 protein homolog 2(At4g07390)

Recombinant Arabidopsis thaliana Mannose-P-dolichol utilization defect 1 protein homolog 2(At4g07390)

SKU:CSB-CF845064DOA

Regular price £1,314.00 GBP
Regular price Sale price £1,314.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8VY63

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDYLGIDMSCAIGSLRNGDFPEKDCLLPLISKLLGYCLVAASITVKLPQIMKIVQHKSVR GLSVVAFELEVVGYTISLAYCLHKGLPFSAFGEMAFLLIQALILVACIYYYSQPVPVTTW IRPLLYCAVAPTVLAGQINPTLFEALYASQHAIFLFARLPQIWKNFKNKSTGELSFLTFF MNFAGSIVRVFTSLQEKAPISILTGFALGVVTNGSILTQILLYSKPAAAKEKKAN

Protein Names:Recommended name: Mannose-P-dolichol utilization defect 1 protein homolog 2

Gene Names:Ordered Locus Names:At4g07390 ORF Names:F28D6.6

Expression Region:1-235

Sequence Info:full length protein

View full details