Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Lipid phosphate phosphatase 2(LPP2)

Recombinant Arabidopsis thaliana Lipid phosphate phosphatase 2(LPP2)

SKU:CSB-CF894979DOA

Regular price £1,345.00 GBP
Regular price Sale price £1,345.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9XI60

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPEIHLGAHTIRSHGVTVARFHMHDWLILLLLIVIEIVLNVIEPFHRFVGEDMLTDLRYP LQDNTIPFWAVPLIAVVLPFAVICVYYFIRNDVYDLHHAILGLLFSVLITGVITDAIKDA VGRPRPDFFWRCFPDGIGIFHNVTKNVLCTGAKDVVKEGHKSFPSGHTSWSFAGLGFLSL YLSGKIRVFDQRGHVAKLCIVILPLLVAALVGVSRVDDYWHHWQDVFGGAIIGLTVATFC YLQFFPPPYDPDGWGPHAYFQMLADSRNDVQDSAGMNHLSVRQTELESVR

Protein Names:Recommended name: Lipid phosphate phosphatase 2 Short name= AtLPP2 EC= 3.1.3.- Alternative name(s): Phosphatidic acid phosphatase 2 Short name= AtPAP2 Prenyl diphosphate phosphatase

Gene Names:Name:LPP2 Synonyms:PAP2 Ordered Locus Names:At1g15080 ORF Names:F9L1.2

Expression Region:1-290

Sequence Info:full length protein

View full details