Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana HVA22-like protein b(HVA22B)

Recombinant Arabidopsis thaliana HVA22-like protein b(HVA22B)

SKU:CSB-CF866026DOA

Regular price £1,239.00 GBP
Regular price Sale price £1,239.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SYX7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSGIGSLVKVIFKNFDVIAGPVISLVYPLYASVRAIESRSHGDDKQWLTYWALYSLIKL FELTFFRLLEWIPLYPYAKLALTSWLVLPGMNGAAYLYEHYVRSFLLSPHTVNVWYVPAK KDDDLGATAGKFTPVNDSGAPQEKIVSSVDTSAKYVGHSAFDDAYIY

Protein Names:Recommended name: HVA22-like protein b Short name= AtHVA22b

Gene Names:Name:HVA22B Ordered Locus Names:At5g62490 ORF Names:K19B1.10

Expression Region:1-167

Sequence Info:full length protein

View full details