Gene Bio Systems
Recombinant Arabidopsis thaliana HVA22-like protein b(HVA22B)
Recombinant Arabidopsis thaliana HVA22-like protein b(HVA22B)
SKU:CSB-CF866026DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9SYX7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSGIGSLVKVIFKNFDVIAGPVISLVYPLYASVRAIESRSHGDDKQWLTYWALYSLIKL FELTFFRLLEWIPLYPYAKLALTSWLVLPGMNGAAYLYEHYVRSFLLSPHTVNVWYVPAK KDDDLGATAGKFTPVNDSGAPQEKIVSSVDTSAKYVGHSAFDDAYIY
Protein Names:Recommended name: HVA22-like protein b Short name= AtHVA22b
Gene Names:Name:HVA22B Ordered Locus Names:At5g62490 ORF Names:K19B1.10
Expression Region:1-167
Sequence Info:full length protein
