Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana High-affinity nitrate transporter 3.2(NRT3.2)

Recombinant Arabidopsis thaliana High-affinity nitrate transporter 3.2(NRT3.2)

SKU:CSB-CF886638DOA

Regular price £1,260.00 GBP
Regular price Sale price £1,260.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SB67

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GKKDRLFTDLQNSIEVTAKPVKDSGVLEAGKDMVTITWKLKSSSAKVDTDTAFKTIQVKL CYAPISQVDRPWRKTDNKLFKDRSCPHEIVSKAYDKTPQSLDWTIGLDIPTGTYFVRAYG IDGDGHEVAYGQSTDEGRTTNLFSVHAISGHHVGLDIASTFFSVFSVVSLFVFFVMEKRK AKLEQRE

Protein Names:Recommended name: High-affinity nitrate transporter 3.2

Gene Names:Name:NRT3.2 Ordered Locus Names:At4g24720 ORF Names:F22K18.80

Expression Region:23-209

Sequence Info:full length protein

View full details