Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1(DAD1)

Recombinant Arabidopsis thaliana Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1(DAD1)

SKU:CSB-CF654395DOA

Regular price £1,198.00 GBP
Regular price Sale price £1,198.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q39080

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKSTSKDAQDLFRSLRSAYSATPTNLKIIDLYVVFAVFTALIQVVYMALVGSFPFNSFL SGVLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIINFLG

Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Short name= Oligosaccharyl transferase subunit DAD1 EC= 2.4.1.119 Alternative name(s): Defender against cell death 1 Short name= AtD

Gene Names:Name:DAD1 Ordered Locus Names:At1g32210 ORF Names:F3C3.14

Expression Region:1-115

Sequence Info:full length protein

View full details