Gene Bio Systems
Recombinant Arabidopsis thaliana CYSTM1 family protein A(At2g41420)
Recombinant Arabidopsis thaliana CYSTM1 family protein A(At2g41420)
SKU:CSB-CF840448DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q8S8M0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSQYNQPPVGVPPPQGYPPEGYPKDAYPPQGYPPQGYPQQGYPPQGYPQQGYPQQGYPPP YAPQYPPPPQHQQQQSSPGFLEGCLAALCCCCLLDACF
Protein Names:Recommended name: CYSTM1 family protein A
Gene Names:Ordered Locus Names:At2g41420 ORF Names:T26J13.1
Expression Region:1-98
Sequence Info:full length protein
