Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 1, chloroplastic(LHCB1.3)

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 1, chloroplastic(LHCB1.3)

SKU:CSB-CF361365DOA

Regular price £1,295.00 GBP
Regular price Sale price £1,295.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P04778

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 1, chloroplastic Alternative name(s): Chlorophyll a-b protein 140 Short name= CAB-140 LHCII type I CAB-1

Gene Names:Name:LHCB1.3 Synonyms:AB140, CAB1 Ordered Locus Names:At1g29930 ORF Names:F1N18.3

Expression Region:36-267

Sequence Info:full length protein

View full details