Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana CASP-like protein At5g54980(At5g54980)

Recombinant Arabidopsis thaliana CASP-like protein At5g54980(At5g54980)

SKU:CSB-CF872212DOA

Regular price £1,267.00 GBP
Regular price Sale price £1,267.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FFT2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRDNNNNNTREEERSSSSKQQQPQAPMSLKIIDSCLRLSVVPLSVATIWLTVTNHESNPD YGNLEYNSIMGLKYMVGVSAISAIYALLSTVSSWVTCLVSKAWLFFIPDQVLAYVMTTSV AGATEIVYLLNKGDKIVTWSEMCSSYPHYCSKLTIALGLHVFVLFFFLFLSVISAYRAFS PFDPPCDSQTNNDA

Protein Names:Recommended name: CASP-like protein At5g54980

Gene Names:Ordered Locus Names:At5g54980 ORF Names:MBG8.25

Expression Region:1-194

Sequence Info:full length protein

View full details