Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana CASP-like protein At5g02060(At5g02060)

Recombinant Arabidopsis thaliana CASP-like protein At5g02060(At5g02060)

SKU:CSB-CF888874DOA

Regular price £1,230.00 GBP
Regular price Sale price £1,230.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LZM5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKMIGSPGTMSGLILRLGQCATAAASIGVMVSSYDFSNYTAFCFLVASMGLQLIWSFGL ACLDVYAIRRKSDLRSPILLSLFTVGDWVTALLALAAACSSAGVTVLFTKDTEFCRQQPA LSCDRFQISVGLSFFNWFLAAISSHTMFWILI

Protein Names:Recommended name: CASP-like protein At5g02060

Gene Names:Ordered Locus Names:At5g02060 ORF Names:T7H20_110

Expression Region:1-152

Sequence Info:full length protein

View full details