Gene Bio Systems
Recombinant Arabidopsis thaliana CASP-like protein At2g28370(At2g28370)
Recombinant Arabidopsis thaliana CASP-like protein At2g28370(At2g28370)
SKU:CSB-CF890374DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9SKN3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNVSHASVHPVEDPPAAATEVENPPRVRMDDMEGMPGTLLGLALRFFQFLFAAAALCVMA STSDFPSVTAFCYLVAATGLQSLWSLALAMVDVYAIMVKRSLQNRRLVSLFAIGDGVTST LTFAAACASAGITVLIDNDLNSCAQNHCVQFETSTALAFISWFAALPSFLFNFWSLASR
Protein Names:Recommended name: CASP-like protein At2g28370
Gene Names:Ordered Locus Names:At2g28370 ORF Names:T1B3.11
Expression Region:1-179
Sequence Info:full length protein
