Gene Bio Systems
Recombinant Arabidopsis thaliana CASP-like protein At1g03700(At1g03700)
Recombinant Arabidopsis thaliana CASP-like protein At1g03700(At1g03700)
SKU:CSB-CF862850DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9LR57
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVKLTQRLGGLVLRFAAFCAALGAVIAMITSRERSSFFVISLVAKYSDLAAFKYFVIANA IVTVYSFLVLFLPKESLLWKFVVVLDLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPIC GQVPRFCDQITGALIAGLVALVLYVFLLIFSIHHVVDPFLLRKS
Protein Names:Recommended name: CASP-like protein At1g03700
Gene Names:Ordered Locus Names:At1g03700 ORF Names:F21B7.30
Expression Region:1-164
Sequence Info:full length protein
