Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET5(SWEET5)

Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET5(SWEET5)

SKU:CSB-CF861845DOA

Regular price £1,307.00 GBP
Regular price Sale price £1,307.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FM10

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDPHTARTIVGIVGNVISFGLFCAPIPTMVKIWKMKSVSEFKPDPYVATVLNCMMWTFY GLPFVQPDSLLVITINGTGLFMELVYVTIFFVFATSPVRRKITIAMVIEVIFMAVVIFCT MYFLHTTKQRSMLIGILCIVFNVIMYAAPLTVMKLVIKTKSVKYMPFFLSLANFMNGVVW VIYACLKFDPYILIPNGLGSLSGIIQLIIYITYYKTTNWNDDDEDKEKRYSNAGIELGQA

Protein Names:Recommended name: Bidirectional sugar transporter SWEET5 Short name= AtSWEET5 Alternative name(s): Protein VEGETATIVE CELL EXPRESSED 1 Short name= AtVEX1

Gene Names:Name:SWEET5 Synonyms:VEX1 Ordered Locus Names:At5g62850 ORF Names:MQB2.17

Expression Region:1-240

Sequence Info:full length protein

View full details