Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Aquaporin TIP1-2(TIP1-2)

Recombinant Arabidopsis thaliana Aquaporin TIP1-2(TIP1-2)

SKU:CSB-CF670353DOA

Regular price £1,314.00 GBP
Regular price Sale price £1,314.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q41963

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLV AAALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACF LLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAI GFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFI DENAHEQLPTTDY

Protein Names:Recommended name: Aquaporin TIP1-2 Alternative name(s): Gamma-tonoplast intrinsic protein 2 Short name= Gamma-TIP2 Salt stress-induced tonoplast intrinsic protein Tonoplast intrinsic protein 1-2 Short name= AtTIP1;2

Gene Names:Name:TIP1-2 Synonyms:SITIP, TIP2 Ordered Locus Names:At3g26520 ORF Names:MFE16.17

Expression Region:1-253

Sequence Info:full length protein

View full details