Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Aquaporin SIP1-1(SIP1-1)

Recombinant Arabidopsis thaliana Aquaporin SIP1-1(SIP1-1)

SKU:CSB-CF864961DOA

Regular price £1,318.00 GBP
Regular price Sale price £1,318.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9M8W5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMGVLKSAIGDMLMTFSWVVLSATFGIQTAAIISAGDFQAITWAPLVILTSLIFVYVSIF TVIFGSASFNPTGSAAFYVAGVPGDTLFSLAIRLPAQAIGAAGGALAIMEFIPEKYKHMI GGPSLQVDVHTGAIAETILSFGITFAVLLIILRGPRRLLAKTFLLALATISFVVAGSKYT GPAMNPAIAFGWAYMYSSHNTWDHIYVYWISSFVGALSAALLFRSIFPPPRPQKKKQKKA

Protein Names:Recommended name: Aquaporin SIP1-1 Alternative name(s): Small basic intrinsic protein 1-1 Short name= AtSIP1;1

Gene Names:Name:SIP1-1 Ordered Locus Names:At3g04090 ORF Names:T6K12.29

Expression Region:1-240

Sequence Info:full length protein

View full details