Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana 3-hydroxyacyl-CoA dehydratase PASTICCINO 2(PAS2)

Recombinant Arabidopsis thaliana 3-hydroxyacyl-CoA dehydratase PASTICCINO 2(PAS2)

SKU:CSB-CF823812DOA

Regular price £1,308.00 GBP
Regular price Sale price £1,308.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8VZB2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGFLSVVRRVYLTLYNWIVFAGWAQVLYLAITTLKETGYENVYDAIEKPLQLAQTAAVL EILHGLVGLVRSPVSATLPQIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEIIRYS FFGFKEALGFAPSWHLWLRYSSFLLLYPTGITSEVGLIYLALPHIKTSEMYSVRMPNILN FSFDFFYATILVLAIYVPGSPHMYRYMLGQRKRALSKSKRE

Protein Names:Recommended name: 3-hydroxyacyl-CoA dehydratase PASTICCINO 2 Short name= AtPAS2 Short name= HACD EC= 4.2.1.- Alternative name(s): Protein PEPINO Short name= PEP Protein tyrosine phosphatase-like protein

Gene Names:Name:PAS2 Synonyms:PEP Ordered Locus Names:At5g10480 ORF Names:F12B17.170

Expression Region:1-221

Sequence Info:full length protein

View full details