Gene Bio Systems
Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_327471 (ARALYDRAFT_327471)
Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_327471 (ARALYDRAFT_327471)
SKU:CSB-CF517148DNZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Uniprot NO.:D7M2M8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVKLTKRIGGLVLRLAAFGAALAALIVMITSRERASFFAVSLEAKYTDMAAFKYFVIANA VVSVYSFLVLFLPKESLLWKFVVVLDLVMTMLLTSSLSAALAVAQVGKKGNANAGWLPIC GQVPKFCDQITGALIAGFVALVLYVLLLLYSLHSVVDPFLLQKS
Protein Names:Recommended name: CASP-like protein ARALYDRAFT_327471
Gene Names:ORF Names:ARALYDRAFT_327471
Expression Region:1-164
Sequence Info:full length protein
