Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aquifex aeolicus Uncharacterized protein aq_2145 (aq_2145)

Recombinant Aquifex aeolicus Uncharacterized protein aq_2145 (aq_2145)

SKU:CSB-CF524171DNV

Regular price £1,282.00 GBP
Regular price Sale price £1,282.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Aquifex aeolicus (strain VF5)

Uniprot NO.:O67901

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANKRKEFIKLNLNKERKAFIELRGINLELLKEFLSSNVLPLTFIGSLLILILTIVYYFT LSGSVNELKNEISKEKSKKERLLSEIKRLEELKKTLETKKAIYEVVKIYNDMVIKILENP VNLPYGYSLQNFSLCAFRFKNCDIQEKLNKDKSFSLDKPIAQLDLVLFNRKLENYIPPDS IRKFTYVVIDNLPYRRVCIEPDYERLLAEKGHRKEE

Protein Names:Recommended name: Uncharacterized protein aq_2145

Gene Names:Ordered Locus Names:aq_2145

Expression Region:1-216

Sequence Info:full length protein

View full details