Skip to product information
1 of 1

Gene Bio Systems

Recombinant Apis mellifera carnica Icarapin

Recombinant Apis mellifera carnica Icarapin

SKU:CSB-EP691648ADAM

Regular price £799.00 GBP
Regular price Sale price £799.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q5EF78

Gene Names: N/A

Organism: Apis mellifera carnica (Carniolan honeybee)

AA Sequence: FPGAHDEDSKEERKNVDTVLVLPSIERDQMMAATFDFPSLSFEDSDEGSNWNWNTLLRPNFLDGWYQTLQSAISAHMKKVREQMAGILSRIPEQGVVNWNKIPEGANTTSTTKIIDGHVVTINETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEADSDVTTLPTLIGKNETSTQSSRSVESVEDFDNEIPKNQGDVLTA

Expression Region: 20-223aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 27.7 kDa

Alternative Name(s): Venom protein 2 Allergen: Api m 10

Relevance:

Reference: "Location and reduction of icarapin antigenicity by site specific coupling to polyethylene glycol." Wong K.L., Li H., Wong K.K., Jiang T., Shaw P.C. Protein Pept. Lett. 19:238-243(2012)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details