Gene Bio Systems
Recombinant Apis mellifera carnica Icarapin
Recombinant Apis mellifera carnica Icarapin
SKU:CSB-EP691648ADAM
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q5EF78
Gene Names: N/A
Organism: Apis mellifera carnica (Carniolan honeybee)
AA Sequence: FPGAHDEDSKEERKNVDTVLVLPSIERDQMMAATFDFPSLSFEDSDEGSNWNWNTLLRPNFLDGWYQTLQSAISAHMKKVREQMAGILSRIPEQGVVNWNKIPEGANTTSTTKIIDGHVVTINETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEADSDVTTLPTLIGKNETSTQSSRSVESVEDFDNEIPKNQGDVLTA
Expression Region: 20-223aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 27.7 kDa
Alternative Name(s): Venom protein 2 Allergen: Api m 10
Relevance:
Reference: "Location and reduction of icarapin antigenicity by site specific coupling to polyethylene glycol." Wong K.L., Li H., Wong K.K., Jiang T., Shaw P.C. Protein Pept. Lett. 19:238-243(2012)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
