Skip to product information
1 of 1

Gene Bio Systems

Recombinant Anopheles gambiae Transmembrane protein 234 homolog (AGAP012180)

Recombinant Anopheles gambiae Transmembrane protein 234 homolog (AGAP012180)

SKU:CSB-CF369405BZL

Regular price £1,220.00 GBP
Regular price Sale price £1,220.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Anopheles gambiae (African malaria mosquito)

Uniprot NO.:A0NGI1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSPENTVPASVDIYAVLSILLVAIMWGATNPFIKRGSIGYNELKADSKLGQLWLEVRFL ITRWQYLLPLVINQLGSIVYVLTLQRTELSLTVPMANSLTFVFTAITARLLGERQSGWKI YCGMTLVILGTVICGLDKML

Protein Names:Recommended name: Transmembrane protein 234 homolog

Gene Names:ORF Names:AGAP012180

Expression Region:1-140

Sequence Info:full length protein

View full details