Skip to product information
1 of 1

Gene Bio Systems

Recombinant Anas platyrhynchos Lysozyme C-1

Recombinant Anas platyrhynchos Lysozyme C-1

SKU:CSB-EP360572BED

Regular price £893.00 GBP
Regular price Sale price £893.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P00705

Gene Names: N/A

Organism: Anas platyrhynchos (Mallard) (Anas boschas)

AA Sequence: MKALLTLVFCLLPLAAQGKVYSRCELAAAMKRLGLDNYRGYSLGNWVCAANYESGFNTQATNRNTDGSTDYGILQINSRWWCDNGKTPRSKNACGIPCSVLLRSDITEAVRCAKRIVSDGDGMNAWVAWRNRCRGTDVSKWIRGCRL

Expression Region: 1-147aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 32.4 kDa

Alternative Name(s): 1,4-beta-N-acetylmuramidase C

Relevance: Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.

Reference: "Chemical and immunological properties and amino acid sequences of three lysozymes from Peking-duck egg white."Kondo K., Fujio H., Amano T. J. Biochem. 91:571-587(1982)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details