Skip to product information
1 of 1

Gene Bio Systems

Recombinant Anas platyrhynchos Cytochrome c oxidase subunit 3(MT-CO3)

Recombinant Anas platyrhynchos Cytochrome c oxidase subunit 3(MT-CO3)

SKU:CSB-CF015074BZD

Regular price £1,169.00 GBP
Regular price Sale price £1,169.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Anas platyrhynchos (Domestic duck) (Anas boschas)

Uniprot NO.:P50657

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAHQAHSYHMVDPSPWPIFGAAAALLTTSGLVMWFHYNSSILLAAGLLSMLLVMLQWWRE IVRESTFQGHHTPTVQKGLRYGMILF

Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide III

Gene Names:Name:MT-CO3 Synonyms:COIII, COXIII, MTCO3

Expression Region:1-86

Sequence Info:full length protein

View full details