Skip to product information
1 of 1

Gene Bio Systems

Recombinant Alteromonas macleodii Lipoprotein signal peptidase(lspA1)

Recombinant Alteromonas macleodii Lipoprotein signal peptidase(lspA1)

SKU:CSB-CF463616AZX

Regular price £1,256.00 GBP
Regular price Sale price £1,256.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Alteromonas macleodii (strain DSM 17117 / Deep ecotype)

Uniprot NO.:B4RVP1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKLFRETGLRFLWISALAFILDQWSKYTVIDTMSLYQSIQVLPFFNFTYVHNYGAAFSF LENAGGWQRWFFTAIAVVVSVVILWWLKQSPRSQKMLPVAFAFILGGALGNVYDRLVHGY VIDFLDFYVNNYHWPAFNIADSAIFIGAALLIIDMFKNGDKKSEENGAESKAGSANSSET IK

Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II

Gene Names:Name:lspA1 Ordered Locus Names:MADE_1004980 ANDName: lspA2Ordered Locus Names: MADE_1012655

Expression Region:1-182

Sequence Info:full length protein

View full details