Skip to product information
1 of 1

Gene Bio Systems

Recombinant Allochromatium vinosum Cytochrome c1(petC)

Recombinant Allochromatium vinosum Cytochrome c1(petC)

SKU:CSB-CF006327AZP

Regular price £1,288.00 GBP
Regular price Sale price £1,288.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / D) (Chromatium vinosum)

Uniprot NO.:O31216

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SGGGEHLESANIDLRDQASLQRGAKYFMNYCTGCHSLQYMRYNRLAKDLGIDEIALRQNL LFGDAKPGDLITKAMTDDDALKWFGVVPPDLTLVTRWRSPDWVYTYLKSFYLDDTRPYGV NNVLFPLVGMPHVLGDLQGRQEAVMEPSHEPGGEPTIKGVKLVEEGGLSPQEYDTMVRDI TNFLTYAGEPFQLERERIGRYVLLFLGFLFILAYLLKKEYWKDVH

Protein Names:Recommended name: Cytochrome c1

Gene Names:Name:petC Ordered Locus Names:Alvin_0070

Expression Region:20-244

Sequence Info:full length protein

View full details