Skip to product information
1 of 1

Gene Bio Systems

Recombinant Alcaligenes xylosoxydans xylosoxydans Nickel-cobalt-cadmium resistance protein nccN(nccN)

Recombinant Alcaligenes xylosoxydans xylosoxydans Nickel-cobalt-cadmium resistance protein nccN(nccN)

SKU:CSB-CF671532AGR

Regular price £1,284.00 GBP
Regular price Sale price £1,284.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Alcaligenes xylosoxydans xylosoxydans (Achromobacter xylosoxidans)

Uniprot NO.:Q44587

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNISLRPAIAAPSPLDSFLTRHRIGIWRVVVSVVLIALITGHSQWDDTWISAALLTVGML GVTMATVGRLWCALYISGRKSTELVTTGPYSMCRHPLYVCNFVGIVGLGAMTESITLAAI LALAFALMYPAVIRSEDHLLSRNFPEFDDYARRTPAFFPRLSLFRSESTYLVHVGSFQRN LADSVWFLGMTIVVNAVELARHAKWLPTFVLLP

Protein Names:Recommended name: Nickel-cobalt-cadmium resistance protein nccN

Gene Names:Name:nccN

Expression Region:1-213

Sequence Info:full length protein

View full details