Gene Bio Systems
Recombinant Ailuropoda melanoleuca ORM1-like protein 3(ORMDL3)
Recombinant Ailuropoda melanoleuca ORM1-like protein 3(ORMDL3)
SKU:CSB-CF017241AYX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ailuropoda melanoleuca (Giant panda)
Uniprot NO.:D2I2F3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNTGM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY
Protein Names:Recommended name: ORM1-like protein 3
Gene Names:Name:ORMDL3 ORF Names:PANDA_019568
Expression Region:1-153
Sequence Info:full length protein
