Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ailuropoda melanoleuca E3 ubiquitin-protein ligase RNF152(RNF152)

Recombinant Ailuropoda melanoleuca E3 ubiquitin-protein ligase RNF152(RNF152)

SKU:CSB-CF019848AYX

Regular price £1,275.00 GBP
Regular price Sale price £1,275.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ailuropoda melanoleuca (Giant panda)

Uniprot NO.:D2H6Z0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKL PPGFSVAQLPDDPEVLAVIAIPHASEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCR LLPGSQQKSVTVVTVPAEQRPLQGGAPQEAVEEEPDRRGVAKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG

Protein Names:Recommended name: E3 ubiquitin-protein ligase RNF152 EC= 6.3.2.- Alternative name(s): RING finger protein 152

Gene Names:Name:RNF152 ORF Names:PANDA_005868

Expression Region:1-203

Sequence Info:full length protein

View full details