Skip to product information
1 of 1

Gene Bio Systems

Recombinant Agrobacterium tumefaciens Protein virB3(virB3)

Recombinant Agrobacterium tumefaciens Protein virB3(virB3)

SKU:CSB-CF325530AYS

Regular price £1,082.00 GBP
Regular price Sale price £1,082.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Uniprot NO.:P17793

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNDRLEEATLYLAATRPALFLGVPLTLAGLLVMFAGFVIVIVQNPLYEVVLVPLWFGARL VVERDYNAASVVLLFLQTAGRSVDGLIWGGASVSPNPIKVPARGRGMA

Protein Names:Recommended name: Protein virB3

Gene Names:Name:virB3 Ordered Locus Names:Atu6169 ORF Names:AGR_pTi_bx137

Expression Region:1-108

Sequence Info:full length protein

View full details