Skip to product information
1 of 1

Gene Bio Systems

Recombinant Agrobacterium tumefaciens Aquaporin Z 2(aqpZ2)

Recombinant Agrobacterium tumefaciens Aquaporin Z 2(aqpZ2)

SKU:CSB-CF837674AYS

Regular price £1,314.00 GBP
Regular price Sale price £1,314.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Uniprot NO.:Q8UJW4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGRKLLAEFFGTFWLVFGGCGSAVFAAAFPELGIGFTGVALAFGLTVLTMAYAVGGISGG HFNPAVSVGLTVAGRFPASSLVPYVIAQVAGAIVAAAALYVIATGKAGIDLGGFASNGYG EHSPGGYSLVSALLIEIILTAFFLIVILGSTHGRVPAGFAPIAIGLALTLIHLISIPVTN TSVNPARSTGQALFVGGWALQQLWLFWLAPIVGGAAGAVIWKLFGEKD

Protein Names:Recommended name: Aquaporin Z 2

Gene Names:Name:aqpZ2 Ordered Locus Names:Atu5361 ORF Names:AGR_pAT_521

Expression Region:1-228

Sequence Info:full length protein

View full details